PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g51961.2.p
Common NameBRADI_1g51961, LOC100837447
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 1239aa    MW: 139131 Da    PI: 6.666
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g51961.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.29.4e-191763147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      +g+WT+eEd+ll+d++  +G+ +W++Iar  g++Rt+k+c++rw++ 
  Bradi1g51961.2.p 17 KGPWTPEEDKLLIDYIGAHGSCRWNSIARLAGLNRTGKSCRLRWLNC 63
                      79******************************************996 PP

2Myb_DNA-binding51.13e-1670115148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       r  +T +E++ll++++  lG++ W+ I  +m+ gRt++++k++w+++l
  Bradi1g51961.2.p  70 RVHFTDDEEKLLINLHSSLGNK-WSEIGTHMP-GRTDNEIKNYWNTHL 115
                       5679******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.2721264IPR017930Myb domain
SuperFamilySSF466896.25E-2915111IPR009057Homeodomain-like
SMARTSM007172.8E-151666IPR001005SANT/Myb domain
PfamPF002494.4E-171763IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.9E-231871IPR009057Homeodomain-like
CDDcd001678.53E-121962No hitNo description
PROSITE profilePS5129425.0765119IPR017930Myb domain
SMARTSM007172.6E-1569117IPR001005SANT/Myb domain
PfamPF002492.5E-1470115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-2372119IPR009057Homeodomain-like
CDDcd001671.01E-1173115No hitNo description
CDDcd147983.05E-7285363No hitNo description
SuperFamilySSF525404.72E-52437712IPR027417P-loop containing nucleoside triphosphate hydrolase
Gene3DG3DSA:3.40.50.3005.5E-14450625IPR027417P-loop containing nucleoside triphosphate hydrolase
PfamPF009312.9E-50468736IPR002182NB-ARC
PRINTSPR003642.5E-11473488No hitNo description
PRINTSPR003642.5E-11547561No hitNo description
PRINTSPR003642.5E-11644658No hitNo description
SuperFamilySSF520581.51E-187811166IPR032675Leucine-rich repeat domain, L domain-like
Gene3DG3DSA:3.80.10.106.4E-6854941IPR032675Leucine-rich repeat domain, L domain-like
PRINTSPR003642.5E-11906922No hitNo description
Gene3DG3DSA:3.80.10.106.4E-610451090IPR032675Leucine-rich repeat domain, L domain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0043531Molecular FunctionADP binding
Sequence ? help Back to Top
Protein Sequence    Length: 1239 aa     Download sequence    Send to blast
MGRSPAAPRY DGDSFKKGPW TPEEDKLLID YIGAHGSCRW NSIARLAGLN RTGKSCRLRW  60
LNCLQPDIKR VHFTDDEEKL LINLHSSLGN KWSEIGTHMP GRTDNEIKNY WNTHLSKKLP  120
AGIVKASCGA GSSSYIQAHP GPSQLFDFST SFDVGHGSGS SIQAGPARFL DFSTSSDFGA  180
GSSSFIQGFQ ADPDLSIFDF SSAGKHTDLL SDVNPHAILE DPPDLDKFYF SPFSGSSSLS  240
IKADPAQPPS SSFSTASGIV LDESACVSSS DISALFDDSV SSSSGAMRPL VGKLSMLLEG  300
SVSISKRVKD GMHLLKDDVE DITSYLDELS RLEDPPPMAK CWMNEVRDLS YDMEDYIDTL  360
LFERPDHLNK NKMKNKKNKL TSHVKIPKRL KCCNCKQTKL KHDFRKYLQD AIERHDRYKL  420
HCCSTLRHRF LSSGRMLPTP YEEAAQIVMD DRTETFINSL VSNDAADQQQ LKVASVLGSG  480
CLGKTTLANV LYNRIGMQFD CRAFIRVPKN PDMKRLFHDL FSQLHHKKQP LPANCNELGI  540
SDNINNYLQD KRYLIVIDGL WDASVWDIIK YAFPKGNRGS RVITTTRIED VALTCCCDNS  600
EHVFEMKPLD DEHSRKLFFN RLFGSESSCP KEFKQVSDEI VDMCGGLPLA IINIASHLAN  660
QQKAVSMDLL IYIRDSLRSD LRSNSTSERT RQVLNISYNN LPDCLKTCLL YLGMYSEGSI  720
LSKDDLVKQW VAEGFTAREW KEQDQDMMER AAGNYFSELI DRRFIQPTYT DYSNKVVSCM  780
VHDMVRDLIA QKSAEQNFIV VVDYNRKNIA LSHKVRRLSL HFGEARYAKT PANIRKSQVR  840
SLGFFGLLEC MPCIGEFKVL RVLNLQLSGC PGDHDHIDLT GISELLQLRY LKIESDVCIK  900
LPNNMRRLQC LETLDIMGAT RLAAVPWDII NLPHLLHLSL PVDTKLLNWI GSMSVTVISQ  960
WSLGKLEYLQ DLHVTISSAN LSCDPESCEG IGMIALRSLL EGHVNLKTVV LAHGSSAKND  1020
SNVFTPWDDM VFPPLVQRFE CSPDCSRFSR IPLGVRNLRN LCILRISVRG LDISCLGILR  1080
SLPALTALSL CLQMAPTDEI IFDKAGFSVL KYFKLRFMIG IASLKFDADA MPDLWKLKLV  1140
FDDIPEIDHQ RDTPTISIEH MPGLKEISAK FGGAASDLEY ASRNIISNHP RNPTINMQLV  1200
AYSSVVDGST KQKQEPDDIM EEPYDIREQP DEYIQQEI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-291511925128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014752343.10.0PREDICTED: putative disease resistance RPP13-like protein 3 isoform X2
TrEMBLA0A0Q3HAR80.0A0A0Q3HAR8_BRADI; Uncharacterized protein
STRINGMLOC_64708.10.0(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10280.19e-47myb domain protein 92